PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa11g074290.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GRAS
Protein Properties Length: 492aa    MW: 55061.8 Da    PI: 6.6705
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa11g074290.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS459.81.7e-1401214912374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     +  L++cA+a+s++dl +a++++++l++++s +g+p+qRl ay++e+L a+la+s+s++yk+l+  +++   s+e l+++++++ev+P++kf+++
  Csa11g074290.1 121 RADLVSCAKAMSENDLMMANSMMEKLRQMVSVSGEPIQRLGAYLLEGLVAQLASSGSSIYKSLNRCPEP--ASTELLSYMHILYEVCPYFKFGYM 213
                     678************************************************************666665..499********************* PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledl 189
                      aN aI ea+++e+rvHiiDf+i+qG QW++L+qa+a+Rp+gpp++RiTg+++ +s   +   l+ +g+rLak+A++++vpfefn+ v+ + +++
  Csa11g074290.1 214 SANGAIAEAMKEENRVHIIDFQIGQGSQWVTLIQAFAARPGGPPRIRITGIDDTTSAyaRGGGLSIVGNRLAKLAKQFNVPFEFNP-VSVSAAEV 307
                     *****************************************************998899999************************.7999**** PP

            GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                     ++++L v+pgEalaVn+++ lh+++desvs+e++rd++L++vkslsPkvv++veqe+++n++ F+ rf+e+++yy+a+f+s++++lpr++++ri+
  Csa11g074290.1 308 KPKNLGVRPGEALAVNFAFVLHHMPDESVSTENHRDRLLRMVKSLSPKVVTLVEQESNTNTAAFFPRFMETMNYYAAMFESIDVTLPRDHKQRIN 402
                     *********************************************************************************************** PP

            GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     vE+++l+r++vn++acega+r+erhe l+kW++r+e+aGF+++pls  +++++k+llr+++++ yr+ee++g+l+lgW++r Lv+ +aW+
  Csa11g074290.1 403 VEQHCLARDVVNIIACEGADRIERHELLGKWKSRFEMAGFTSYPLSPLVNSTIKSLLRTYSNK-YRLEERDGALYLGWMHRDLVASCAWK 491
                     *************************************************************66.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098569.81694472IPR005202Transcription factor GRAS
PfamPF035145.8E-138121491IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0005737Cellular Componentcytoplasm
GO:0004871Molecular Functionsignal transducer activity
Sequence ? help Back to Top
Protein Sequence    Length: 492 aa     Download sequence    Send to blast
MYKQPRQEIE AYSFEPNPSG KLRYLPVNNS RKRFCTLEPS PDSPAYNALS STATYEDTCG  60
SCVTDDLNDF KHKIKEIETV MMGPDSLDLV VDGTDSFDST ACQEINSWRS TLEAISRRDL  120
RADLVSCAKA MSENDLMMAN SMMEKLRQMV SVSGEPIQRL GAYLLEGLVA QLASSGSSIY  180
KSLNRCPEPA STELLSYMHI LYEVCPYFKF GYMSANGAIA EAMKEENRVH IIDFQIGQGS  240
QWVTLIQAFA ARPGGPPRIR ITGIDDTTSA YARGGGLSIV GNRLAKLAKQ FNVPFEFNPV  300
SVSAAEVKPK NLGVRPGEAL AVNFAFVLHH MPDESVSTEN HRDRLLRMVK SLSPKVVTLV  360
EQESNTNTAA FFPRFMETMN YYAAMFESID VTLPRDHKQR INVEQHCLAR DVVNIIACEG  420
ADRIERHELL GKWKSRFEMA GFTSYPLSPL VNSTIKSLLR TYSNKYRLEE RDGALYLGWM  480
HRDLVASCAW K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-661244918375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1534430.0AF153443.1 Arabidopsis thaliana phytochrome A signal transduction 1 protein (PAT1) mRNA, complete cds.
GenBankAK3172520.0AK317252.1 Arabidopsis thaliana AT5G48150 mRNA, complete cds, clone: RAFL22-43-D17.
GenBankAK3177470.0AK317747.1 Arabidopsis thaliana AT5G48150 mRNA, complete cds, clone: RAFL22-04-F15.
GenBankBT0253260.0BT025326.1 Arabidopsis thaliana At5g48150 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010442232.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_010442233.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_010442234.10.0PREDICTED: scarecrow-like transcription factor PAT1
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLR0G9L10.0R0G9L1_9BRAS; Uncharacterized protein
STRINGscaffold_801100.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM62128141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein